PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21769
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MIKC_MADS
Protein Properties Length: 218aa    MW: 23684.8 Da    PI: 10.3628
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21769genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.4e-29959151
              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
              krien++ rqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs +g+lyey+s
  EMT21769  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSARGRLYEYAS 59
              79***********************************************86 PP

2K-box67.16.1e-23841391469
     K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                 ++qqe+akL+ +i++Lq+ +R+l+Ge++++L+lkeL++Le++L+k++ +iR+kK
  EMT21769  84 DVNSQQESAKLRHQIQSLQNANRNLMGESVGNLTLKELKSLENRLDKGIGRIRAKK 139
               5689***************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.179161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-31273IPR002100Transcription factor, MADS-box
CDDcd002654.75E-43271No hitNo description
PRINTSPR004041.6E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.75484184IPR002487Transcription factor, K-box
PfamPF014868.6E-1786139IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0009860Biological Processpollen tube growth
GO:0009886Biological Processpost-embryonic morphogenesis
GO:0009909Biological Processregulation of flower development
GO:0048441Biological Processpetal development
GO:0048443Biological Processstamen development
GO:0048481Biological Processplant ovule development
GO:0048507Biological Processmeristem development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFSA RGRLYEYASN  60
STRTTIDRYK KASASASGSA PAIDVNSQQE SAKLRHQIQS LQNANRNLMG ESVGNLTLKE  120
LKSLENRLDK GIGRIRAKKV AEAERLALAA PPPSSGSGAE LEVLPTFDAR SYYHHQAVNM  180
LQDAAAASSS SRYSQSSQAA AATTALHLGY QIKGAQLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-20173173Myocyte-specific enhancer factor 2B
1tqe_R2e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q2e-20173173Myocyte-specific enhancer factor 2B
1tqe_P2e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028950.0AM502895.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM27B (WM27B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266821.11e-104uncharacterized protein LOC100832541
RefseqXP_010230319.11e-104PREDICTED: uncharacterized protein LOC100832541 isoform X1
SwissprotQ8RU316e-88MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLM8BIK41e-158M8BIK4_AEGTA; MADS-box transcription factor 21
STRINGBRADI2G25090.11e-103(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.22e-66MIKC_MADS family protein